Products

View as table Download

Mouse Anti-Human RAC1 Monoclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Caspase 8 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal IL-1 beta antibody

Applications WB
Reactivities Human, Primate, Dog
Conjugation Unconjugated
Immunogen This antibody was prepared by repeated immunizations with recombinant human IL-1β produced in E.coli. The MW of the recombinant 153 aa IL-1β was 17 kDa with the N-terminal amino acid at position alanine 117. This cleavage site is generated by the IL-1β converting enzyme (ICE, capase-1).

Mouse monoclonal AKT1 Antibody(Ascites)

Applications WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated

Rabbit Polyclonal Anti-PIK3R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIK3R3 antibody is: synthetic peptide directed towards the C-terminal region of Human PIK3R3. Synthetic peptide located within the following region: DAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIK

Rabbit Polyclonal Anti-Osteopontin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Osteopontin Antibody: A synthesized peptide derived from human Osteopontin

Anti-JNK1 (JNK1) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TLR4 mouse monoclonal antibody, clone HTA125, Biotin

Applications FC
Reactivities Canine, Guinea Pig, Human, Monkey, Porcine
Conjugation Biotin

Mouse Monoclonal Anti-TNF-alpha Antibody

Reactivities Human
Conjugation Unconjugated