Products

View as table Download

YIF1B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 81-110 amino acids from the N-terminal region of human YIF1B

Rabbit Polyclonal Anti-YIF1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-YIF1B Antibody: synthetic peptide directed towards the middle region of human YIF1B. Synthetic peptide located within the following region: LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA

YIF1B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human YIF1B