Products

View as table Download

Mouse Monoclonal Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A))

Applications ICC/IF, IHC, WB
Reactivities Bovine, Canine, Human, Porcine, Rabbit, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ATP1B1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP1B1 antibody: synthetic peptide directed towards the middle region of human ATP1B1. Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL