Germany
Japan
United Kingdom
China
Products
View as table Download
Transient overexpression lysate of fibroblast growth factor 18 (FGF18)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
FGF18 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human FGF18 |
FGF18 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-FGF18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF18 antibody is: synthetic peptide directed towards the C-terminal region of Human FGF18. Synthetic peptide located within the following region: GKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRE |
Active filters
Target Symbol
- FGF18
Applications
- WB