Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-CD200 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: GTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP |
Rabbit Polyclonal Anti-CD200 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: PRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTD |
CD200 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CD200 |
CD200 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of CD200 molecule (CD200), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of CD200 molecule (CD200), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
LY424074 is the same product as LY425122.
CD200 Rabbit pAb
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CD200
Applications
- WB