LIS1 (PAFAH1B1) (397-410) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Bat, Chicken, Equine, Hamster, Monkey, Rabbit, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Peptide from (C-term) of the protein sequence according to NP_000421 |
Rabbit polyclonal Anti-PAFAH1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAFAH1B1 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B1. Synthetic peptide located within the following region: MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL |
Germany
Japan
United Kingdom
China
