Products

View as table Download

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG

Rabbit polyclonal Catenin-beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1.

beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

beta Catenin (CTNNB1) pSer37 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications Phospho-specific

Rabbit polyclonal beta Catenin antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse, Bovine, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus.

beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Catenin-beta (Ab-489) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).

Rabbit Polyclonal Catenin-β Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Catenin-β

Rabbit Polyclonal Catenin- beta (Ser33) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Serine 33
Modifications Phospho-specific

Rabbit Polyclonal Catenin- beta (Tyr489) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Tyrosine 489
Modifications Phospho-specific

Rabbit Polyclonal Catenin-β (Ser37) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Catenin-β around the phosphorylation site of Serine 37
Modifications Phospho-specific