Products

View as table Download

PPP2R5C rabbit polyclonal antibody, Purified

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Antibody raised against synthetic peptide corresponding to amino acids 53 to 66 of the mammalian protein phosphatase 2 A/B conjugated to KLH.

Rabbit Polyclonal Anti-PPP2R5C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5C antibody: synthetic peptide directed towards the middle region of human PPP2R5C. Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK

PP2A-B56γ/PR61γ/PPP2R5C Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human PP2A-B56γ/PR61γ/PP2A-B56γ/PR61γ/PPP2R5C (NP_848702.1).
Modifications Unmodified