Products

View as table Download

Rabbit polyclonal anti-STAG3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human STAG3.

Rabbit Polyclonal Anti-STAG3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STAG3 Antibody: synthetic peptide directed towards the middle region of human STAG3. Synthetic peptide located within the following region: VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS