Products

View as table Download

Rabbit polyclonal anti-SGOL1 (QORX) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human QORX.

Rabbit polyclonal anti-SGOL1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SGOL1.

Rabbit Polyclonal Anti-SGOL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGOL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGOL1. Synthetic peptide located within the following region: NSDRPVTRPLAKRALKYTDEKETEGSKPTKTPTTTPPETQQSPHLSLKDI

Rabbit Polyclonal Anti-SGOL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGOL1 Antibody: A synthesized peptide derived from human SGOL1