Products

View as table Download

Rabbit Polyclonal Anti-RPS6KA2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RPS6KA2

Rabbit Anti-Ribosomal S6 kinase 2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH

Rabbit polyclonal anti-S6K-a2 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human S6K-a2.

Rabbit Polyclonal Anti-RPS6KA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS6KA2 Antibody: synthetic peptide directed towards the middle region of human RPS6KA2. Synthetic peptide located within the following region: LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR