Products

View as table Download

Rabbit Polyclonal Anti-BLNK Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BLNK

Rabbit polyclonal BLNK (Tyr84) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human BLNK around the phosphorylation site of tyrosine 84 (E-M-YP-V-M).
Modifications Phospho-specific

Rabbit polyclonal antibody to B-cell linker protein (B-cell linker)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 394 and 456 of BLNK (Uniprot ID#Q8WV28)

Rabbit Polyclonal BLNK Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BLNK

Rabbit Polyclonal BLNK (Tyr96) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BLNK around the phosphorylation site of Tyrosine 96
Modifications Phospho-specific

BLNK (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This BLNK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the Center region of human BLNK.

Rabbit Polyclonal Anti-BLNK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BLNK antibody: synthetic peptide directed towards the middle region of human BLNK. Synthetic peptide located within the following region: QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV