Products

View as table Download

ENPP2 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human ENPP2

Anti-AGPAT2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 244-278 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 2

Anti-AGPS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human alkylglycerone phosphate synthase

Calcium independent Phospholipase A2 (PLA2G6) (Center) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 558-588aa) of human PLA2G6.

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A

PLA2G2D (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 112-138 amino acids from the C-terminal region of human PLA2G2D

Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20)

Rabbit polyclonal PLA2G7 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PLA2G7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the Central region of human PLA2G7.

Rabbit Polyclonal Anti-PAFAH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PAFAH2

Rabbit Polyclonal LIS1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LIS1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human LIS1.

AGPAT2 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CHPT1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 7-33 aa) of human Cholinephosphotransferase 1/CHPT1.

Rabbit Polyclonal Anti-LYCAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE

PLA2G12A (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 54-83 amino acids from the Central region of human PLA2G12A

Rabbit polyclonal PLD2 (Ab-169) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PLD2.