Research Areas

Proteins (13)
cDNA Clones (7)
Antibodies (1)
Gene Expression (1)
Jump to Filters
View as table Download
MCP2 (CCL8) (NM_005623) Human Tagged ORF Clone
RC221610

USD 150.00

In Stock

CCL8 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 8 (CCL8)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MCP2 (CCL8) (NM_005623) Human Tagged ORF Clone
RG221610

USD 350.00

In Stock

CCL8 (tGFP-tagged) - Human chemokine (C-C motif) ligand 8 (CCL8)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MCP2 (CCL8) Human Gene Knockout Kit (CRISPR)
KN421610

USD 1,657.00

2 Weeks

CCL8 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
MCP2 (CCL8) (NM_005623) Human Tagged Lenti ORF Clone
RC221610L4

USD 450.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) ligand 8 (CCL8), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MCP2 (CCL8) (NM_005623) Human Recombinant Protein
TP723788

USD 430.00

5 Days

Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8 / MCP-2)

Tag Tag Free
Expression Host E. coli
MCP2 (CCL8) (NM_005623) Human Over-expression Lysate
LC417180

USD 134.00

In Stock

CCL8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MCP2 (CCL8) (NM_005623) Human Over-expression Lysate
LY417180

USD 436.00

In Stock

Transient overexpression lysate of chemokine (C-C motif) ligand 8 (CCL8)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MCP2 (CCL8) (NM_005623) Human Recombinant Protein
TP790101

USD 871.00

In Stock

Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8), esidues 24-99aa, with C-terminal DDK tag,expressed in human cells;

Tag C-DDK
Expression Host HEK293
MCP2 (CCL8) Rabbit Polyclonal Antibody
TA330381

USD 539.00

5 Days

Rabbit Polyclonal Anti-CCL8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL8 antibody: synthetic peptide directed towards the middle region of human CCL8. Synthetic peptide located within the following region: SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
MCP2 (CCL8) (NM_005623) Human Recombinant Protein
TP720051

USD 330.00

7 Weeks

Recombinant protein of human chemokine (C-C motif) ligand 8 (CCL8)

Tag Tag Free
Expression Host E. coli
MCP2 (CCL8) (NM_005623) Human Tagged Lenti ORF Clone
RC221610L3

USD 450.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) ligand 8 (CCL8), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MCP2 (CCL8) (NM_005623) Human Recombinant Protein
TP720051L

USD 1,900.00

9 Weeks

Recombinant protein of human chemokine (C-C motif) ligand 8 (CCL8)

Tag Tag Free
Expression Host E. coli
MCP2 (CCL8) (NM_005623) Human Recombinant Protein
TP720051M

USD 760.00

7 Weeks

Recombinant protein of human chemokine (C-C motif) ligand 8 (CCL8)

Tag Tag Free
Expression Host E. coli