Research Areas

cDNA Clones (11)
Antibodies (5)
Proteins (3)
Jump to Filters
View as table Download
Frizzled 10 (FZD10) (NM_007197) Human Tagged ORF Clone
RG209717

USD 1,011.00

In Stock

FZD10 (tGFP-tagged) - Human frizzled family receptor 10 (FZD10)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Frizzled 10 (FZD10) Rabbit Polyclonal Antibody
TA322436

USD 380.00

In Stock

Anti-FZD10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 171-185 amino acids of human frizzled family receptor 10
Frizzled 10 (FZD10) Rabbit Polyclonal Antibody
TA356128

USD 539.00

5 Days

FZD10 Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
Frizzled 10 (FZD10) (NM_007197) Human Untagged Clone
SC115678

USD 812.00

In Stock

FZD10 (untagged)-Human frizzled family receptor 10 (FZD10)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Frizzled 10 (FZD10) (NM_007197) Human Tagged Lenti ORF Clone
RC209717L2

USD 1,111.00

3 Weeks

Lenti ORF clone of Human frizzled family receptor 10 (FZD10), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Frizzled 10 (FZD10) Rabbit Polyclonal Antibody
TA315158

USD 380.00

In Stock

Rabbit polyclonal anti-FZD10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD10.
Frizzled 10 (FZD10) (NM_007197) Human Over-expression Lysate
LC416131

USD 134.00

In Stock

FZD10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Frizzled 10 (FZD10) (NM_007197) Human Over-expression Lysate
LY416131

USD 436.00

In Stock

Transient overexpression lysate of frizzled homolog 10 (Drosophila) (FZD10)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB