Research Areas

View as table Download

Anti-ALDH1A2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 5-19 amino acids of human aldehyde dehydrogenase 1 family, member A2

Anti-ALDH1A2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 5-19 amino acids of human aldehyde dehydrogenase 1 family, member A2

Rabbit Polyclonal antibody to ALDH1A2 (aldehyde dehydrogenase 1 family, member A2)

Applications WB
Reactivities Human, Mouse (Predicted: Chicken, Rat, Xenopus, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 278 and 518 of ALDH1A2 (Uniprot ID#O94788)

Rabbit polyclonal anti-ALDH1A2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of humanALDH1A2.

Rabbit Polyclonal Anti-ALDH1A2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Aldh1a2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Aldh1a2. Synthetic peptide located within the following region: ALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEV