Research Areas

cDNA Clones (10)
Proteins (7)
Antibodies (2)
Jump to Filters
View as table Download
ITGA8 (NM_003638) Human Tagged ORF Clone
RC218936

USD 925.00

In Stock

ITGA8 (Myc-DDK-tagged)-Human integrin, alpha 8 (ITGA8)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ITGA8 (NM_001291494) Human Tagged ORF Clone
RG239915

USD 1,203.00

2 Weeks

ITGA8 (tGFP-tagged) - Human integrin, alpha 8 (ITGA8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ITGA8 (NM_001291494) Human Tagged ORF Clone
RC239915

USD 1,003.00

4 Weeks

ITGA8 (myc-DDK-tagged) - Human integrin, alpha 8 (ITGA8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ITGA8 (NM_003638) Human Tagged ORF Clone
RG218936

USD 1,125.00

3 Weeks

ITGA8 (tGFP-tagged) - Human integrin, alpha 8 (ITGA8)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ITGA8 (C-term) Rabbit Polyclonal Antibody
AP52252PU-N

USD 580.00

2 Weeks

ITGA8 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1032-1061 amino acids from the C-terminal region of human ITGA8
ITGA8 (NM_003638) Human Tagged Lenti ORF Clone
RC218936L4

USD 1,225.00

3 Weeks

Lenti ORF clone of Human integrin, alpha 8 (ITGA8), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ITGA8 (NM_003638) Human Tagged Lenti ORF Clone
RC218936L3

USD 1,225.00

5 Days

Lenti ORF clone of Human integrin, alpha 8 (ITGA8), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ITGA8 Rabbit Polyclonal Antibody
TA338225

USD 539.00

5 Days

Rabbit Polyclonal Anti-ITGA8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGA8 antibody: synthetic peptide directed towards the N terminal of human ITGA8. Synthetic peptide located within the following region: GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI
ITGA8 (NM_003638) Human Over-expression Lysate
LC418532

USD 206.00

2 Weeks

ITGA8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ITGA8 (NM_003638) Human Over-expression Lysate
LY418532

USD 665.00

5 Days

Transient overexpression lysate of integrin, alpha 8 (ITGA8)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB