Research Areas

View as table Download

Rabbit Polyclonal antibody to Edc3 (enhancer of mRNA decapping 3 homolog (S. cerevisiae))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 127 and 376 of Edc3 (Uniprot ID#Q96F86)

Rabbit Polyclonal Anti-EDC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDC3 antibody is: synthetic peptide directed towards the middle region of Human EDC3. Synthetic peptide located within the following region: KKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDT