Research Areas

View as table Download

PIK3CB (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PIK3CB (Myc-DDK tagged) - Homo sapiens phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta (PIK3CB), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PIK3CB (tGFP-tagged) - Homo sapiens phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta (PIK3CB), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PIK3CB (tGFP-tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIK3CB

Lenti ORF clone of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, PIK3CB (Myc-DDK tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, PIK3CB (mGFP-tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, PIK3CB (Myc-DDK tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PIK3CB (mGFP-tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB. Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD

Purified recombinant protein of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), Cys287-Lys575, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIK3CB antibody is: synthetic peptide directed towards the N-terminal region of Human PIK3CB. Synthetic peptide located within the following region: ENATALHVKFPENKKQPYYYPPFDKSRGGKKFLPVLKEILDRDPLSQLCE