EIF4E1B (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
EIF4E1B (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EIF4E1B (tGFP-tagged) - Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EIF4E1B (Myc-DDK tagged) - Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EIF4E1B (mGFP-tagged) - Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-EIF4E1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EIF4E1B Antibody is: synthetic peptide directed towards the N-terminal region of Human EIF4E1B. Synthetic peptide located within the following region: EKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWA |
Rabbit Polyclonal Anti-EIF4E1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EIF4E1B Antibody is: synthetic peptide directed towards the middle region of Human EIF4E1B. Synthetic peptide located within the following region: CDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLI |
EIF4E1B (untagged)-Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |