Research Areas

View as table Download

EIF4E1B (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

EIF4E1B (tGFP-tagged) - Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, EIF4E1B (Myc-DDK tagged) - Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, EIF4E1B (mGFP-tagged) - Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-EIF4E1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EIF4E1B Antibody is: synthetic peptide directed towards the N-terminal region of Human EIF4E1B. Synthetic peptide located within the following region: EKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWA

Rabbit Polyclonal Anti-EIF4E1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EIF4E1B Antibody is: synthetic peptide directed towards the middle region of Human EIF4E1B. Synthetic peptide located within the following region: CDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLI

EIF4E1B (untagged)-Human eukaryotic translation initiation factor 4E family member 1B (EIF4E1B)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin