Research Areas

cDNA Clones (12)
Antibodies (7)
Proteins (3)
Jump to Filters
View as table Download
AMPK alpha 2 (PRKAA2) (NM_006252) Human Tagged ORF Clone Lentiviral Particle
RC210226L1V

USD 1,321.00

2 Weeks

Lenti ORF particles, PRKAA2 (Myc-DDK tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
AMPK alpha 2 (PRKAA2) (NM_006252) Human Tagged ORF Clone Lentiviral Particle
RC210226L2V

USD 1,321.00

2 Weeks

Lenti ORF particles, PRKAA2 (mGFP-tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
AMPK alpha 2 (PRKAA2) (NM_006252) Human Tagged ORF Clone Lentiviral Particle
RC210226L3V

USD 1,321.00

5 Weeks

Lenti ORF particles, PRKAA2 (Myc-DDK tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AMPK alpha 2 (PRKAA2) (NM_006252) Human Tagged ORF Clone Lentiviral Particle
RC210226L4V

USD 1,321.00

2 Weeks

Lenti ORF particles, PRKAA2 (mGFP-tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AMPK alpha 2 (PRKAA2) (NM_006252) Human Tagged ORF Clone
RG210226

USD 971.00

In Stock

PRKAA2 (tGFP-tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AMPK alpha 2 (PRKAA2) Rabbit Polyclonal Antibody
TA308756

USD 625.00

5 Days

Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Chicken, Pig, Rat, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646)
AMPK alpha 2 (PRKAA2) Rabbit Polyclonal Antibody
TA322519

USD 380.00

In Stock

Anti-PRKAA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit
AMPK alpha 2 (PRKAA2) (Center)/(Thr172) Rabbit Polyclonal Antibody
AP53442PU-N

USD 580.00

2 Weeks

AMPK alpha 2 (PRKAA2) (Center)/(Thr172) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 145-173 amino acids from the Central region of human PRKAA2 (Thr172)
AMPK alpha 2 (PRKAA2) (NM_006252) Human Untagged Clone
SC116247

USD 772.00

In Stock

PRKAA2 (untagged)-Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
AMPK alpha 2 (PRKAA2) (NM_006252) Human Tagged Lenti ORF Clone
RC210226L4

USD 1,071.00

In Stock

Lenti ORF clone of Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AMPK alpha 2 (PRKAA2) Rabbit Polyclonal Antibody
TA345140

USD 539.00

5 Days

Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP
AMPK alpha 2 (PRKAA2) Rabbit Polyclonal Antibody
TA309997

USD 565.00

3 Weeks

Rabbit anti-PRKAA2 (AMPK1/AMPK2, Phospho-Ser485/Ser491) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanAMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G- SP-V-S).
Modifications Phospho-specific