Research Areas

cDNA Clones (11)
Proteins (4)
Antibodies (2)
Jump to Filters
View as table Download
CSNK1A1L (NM_145203) Human Tagged ORF Clone
RC206077

USD 457.00

In Stock

CSNK1A1L (Myc-DDK-tagged)-Human casein kinase 1, alpha 1-like (CSNK1A1L)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CSNK1A1L (NM_145203) Human Tagged ORF Clone Lentiviral Particle
RC206077L1V

USD 1,007.00

2 Weeks

Lenti ORF particles, CSNK1A1L (Myc-DDK tagged) - Human casein kinase 1, alpha 1-like (CSNK1A1L), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CSNK1A1L (NM_145203) Human Tagged ORF Clone Lentiviral Particle
RC206077L2V

USD 1,007.00

5 Weeks

Lenti ORF particles, CSNK1A1L (mGFP-tagged) - Human casein kinase 1, alpha 1-like (CSNK1A1L), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CSNK1A1L (NM_145203) Human Tagged ORF Clone Lentiviral Particle
RC206077L4V

USD 1,007.00

5 Weeks

Lenti ORF particles, CSNK1A1L (mGFP-tagged) - Human casein kinase 1, alpha 1-like (CSNK1A1L), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CSNK1A1L (NM_145203) Human Tagged ORF Clone
RG206077

USD 657.00

In Stock

CSNK1A1L (tGFP-tagged) - Human casein kinase 1, alpha 1-like (CSNK1A1L)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CSNK1A1L Rabbit Polyclonal Antibody
TA316058

USD 380.00

In Stock

Rabbit polyclonal anti-CKI-a1/L antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a1/L.
CSNK1A1L (NM_145203) Human Tagged Lenti ORF Clone
RC206077L1

USD 757.00

In Stock

Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CSNK1A1L (NM_145203) Human Recombinant Protein
TP760141

USD 261.00

In Stock

Recombinant protein of human casein kinase 1, alpha 1-like (CSNK1A1L), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
CSNK1A1L Rabbit Polyclonal Antibody
TA340392

USD 539.00

5 Days

Rabbit Polyclonal Anti-CSNK1A1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1A1L antibody: synthetic peptide directed towards the middle region of human CSNK1A1L. Synthetic peptide located within the following region: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD
CSNK1A1L (NM_145203) Human Over-expression Lysate
LC407942

USD 134.00

2 Weeks

CSNK1A1L HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CSNK1A1L (NM_145203) Human Over-expression Lysate
LY407942

USD 436.00

5 Days

Transient overexpression lysate of casein kinase 1, alpha 1-like (CSNK1A1L)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CSNK1A1L (NM_145203) Human Tagged Lenti ORF Clone
RC206077L2

USD 757.00

3 Weeks

Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CSNK1A1L (NM_145203) Human Tagged Lenti ORF Clone
RC206077L3

USD 757.00

3 Weeks

Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CSNK1A1L (NM_145203) Human Tagged Lenti ORF Clone
RC206077L4

USD 757.00

3 Weeks

Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®