PLA2G2C (Myc-DDK-tagged)-Human phospholipase A2, group IIC (PLA2G2C)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLA2G2C (Myc-DDK-tagged)-Human phospholipase A2, group IIC (PLA2G2C)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PLA2G2C (Myc-DDK tagged) - Human phospholipase A2, group IIC (PLA2G2C), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, PLA2G2C (mGFP-tagged) - Human phospholipase A2, group IIC (PLA2G2C), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
PLA2G2C (tGFP-tagged) - Human phospholipase A2, group IIC (PLA2G2C)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phospholipase A2, group IIC (PLA2G2C), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phospholipase A2, group IIC (PLA2G2C), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-PLA2G2C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G2C antibody is: synthetic peptide directed towards the middle region of Human PLA2G2C. Synthetic peptide located within the following region: LGDKGIPVDDTDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTL |
PLA2G2C HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of phospholipase A2, group IIC (PLA2G2C)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PLA2G2C (untagged)-Human phospholipase A2, group IIC (PLA2G2C)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of PLA2G2C in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack
Other Names | phospholipase A2, group IIC; phospholipase A2, group IIC (possible pseudogene) |
Accession Number | NM_001105572, NP_001099042 |