Research Areas

View as table Download

PLA2G2C (Myc-DDK-tagged)-Human phospholipase A2, group IIC (PLA2G2C)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, PLA2G2C (Myc-DDK tagged) - Human phospholipase A2, group IIC (PLA2G2C), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, PLA2G2C (mGFP-tagged) - Human phospholipase A2, group IIC (PLA2G2C), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PLA2G2C (tGFP-tagged) - Human phospholipase A2, group IIC (PLA2G2C)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human phospholipase A2, group IIC (PLA2G2C), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human phospholipase A2, group IIC (PLA2G2C), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-PLA2G2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G2C antibody is: synthetic peptide directed towards the middle region of Human PLA2G2C. Synthetic peptide located within the following region: LGDKGIPVDDTDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTL

PLA2G2C HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of phospholipase A2, group IIC (PLA2G2C)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PLA2G2C (untagged)-Human phospholipase A2, group IIC (PLA2G2C)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

USD 1,174.00

4 Weeks

Transient overexpression of PLA2G2C in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Other Names phospholipase A2, group IIC; phospholipase A2, group IIC (possible pseudogene)
Accession Number NM_001105572, NP_001099042