Research Areas

cDNA Clones (15)
Antibodies (10)
Proteins (2)
Jump to Filters
View as table Download
PPAP2A (PLPP1) (NM_003711) Human Tagged ORF Clone
RC208064

USD 300.00

In Stock

PPAP2A (Myc-DDK-tagged)-Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPAP2A (PLPP1) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
TA506857

USD 447.00

In Stock

PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
PPAP2A (PLPP1) (NM_003711) Human Tagged ORF Clone Lentiviral Particle
RC208064L3V

USD 850.00

5 Weeks

Lenti ORF particles, PPAP2A (Myc-DDK tagged) - Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPAP2A (PLPP1) (NM_003711) Human Tagged ORF Clone Lentiviral Particle
RC208064L4V

USD 850.00

5 Weeks

Lenti ORF particles, PPAP2A (mGFP-tagged) - Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPAP2A (PLPP1) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
CF506857

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
PPAP2A (PLPP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]
TA506857AM

USD 509.00

2 Weeks

PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
PPAP2A (PLPP1) (NM_003711) Human Tagged ORF Clone
RG208064

USD 500.00

In Stock

PPAP2A (tGFP-tagged) - Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPAP2A (PLPP1) (NM_176895) Human Tagged ORF Clone
RG223188

USD 530.00

In Stock

PPAP2A (tGFP-tagged) - Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPAP2A (PLPP1) (NM_176895) Human Tagged ORF Clone
RC223188

USD 330.00

3 Weeks

PPAP2A (Myc-DDK-tagged)-Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322830

USD 380.00

4 Weeks

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322829

USD 380.00

In Stock

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
PPAP2A (PLPP1) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
TA506857S

USD 200.00

2 Days

PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
PPAP2A (PLPP1) (NM_003711) Human Over-expression Lysate
LC418483

USD 134.00

In Stock

PPAP2A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA329515

USD 485.00

5 Days

Rabbit Polyclonal anti-PPAP2A antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV