PPAP2A (Myc-DDK-tagged)-Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPAP2A (Myc-DDK-tagged)-Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 850.00
5 Weeks
Lenti ORF particles, PPAP2A (Myc-DDK tagged) - Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 850.00
5 Weeks
Lenti ORF particles, PPAP2A (mGFP-tagged) - Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Carrier-free (BSA/glycerol-free) PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
PPAP2A (tGFP-tagged) - Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPAP2A (tGFP-tagged) - Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPAP2A (Myc-DDK-tagged)-Human phosphatidic acid phosphatase type 2A (PPAP2A), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Anti-PPAP2A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Anti-PPAP2A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PPAP2A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal anti-PPAP2A antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |