PLA2G4E (Myc-DDK-tagged)-Human phospholipase A2, group IVE (PLA2G4E)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLA2G4E (Myc-DDK-tagged)-Human phospholipase A2, group IVE (PLA2G4E)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PLA2G4E (Myc-DDK tagged) - Human phospholipase A2, group IVE (PLA2G4E), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLA2G4E (mGFP-tagged) - Human phospholipase A2, group IVE (PLA2G4E), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PLA2G4E (tGFP-tagged) - Homo sapiens phospholipase A2, group IVE (PLA2G4E)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PLA2G4E (tGFP-tagged) - Human phospholipase A2, group IVE (PLA2G4E)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PLA2G4E (Myc-DDK tagged) - Homo sapiens phospholipase A2, group IVE (PLA2G4E)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PLA2G4E Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G4E antibody: synthetic peptide directed towards the c terminal of human PLA2G4E. Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT |
Lenti ORF clone of Human phospholipase A2, group IVE (PLA2G4E), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PLA2G4E HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of phospholipase A2, group IVE (PLA2G4E)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-PLA2G4E antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PLA2G4E. |
Lenti ORF clone of Human phospholipase A2, group IVE (PLA2G4E), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
PLA2G4E (untagged)-Human phospholipase A2, group IVE (PLA2G4E)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PLA2G4E (untagged) - Homo sapiens phospholipase A2, group IVE (PLA2G4E)
Vector | pCMV6-Entry |
Tag | Tag Free |
Transient overexpression of PLA2G4E in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack
Applications | IHC |
Other Names | FLJ45651; MGC126633; MGC126661 |
Accession Number | NM_001080490, NP_001073959 |