GTF2A1L mouse monoclonal antibody,clone OTI1D3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GTF2A1L mouse monoclonal antibody,clone OTI1D3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2A1L mouse monoclonal antibody,clone OTI1D3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GTF2A1L mouse monoclonal antibody,clone OTI1D3, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
GTF2A1L mouse monoclonal antibody,clone OTI1D3, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GTF2A1L mouse monoclonal antibody,clone OTI4B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2A1L mouse monoclonal antibody,clone OTI4B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GTF2A1L mouse monoclonal antibody,clone OTI4B4, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
GTF2A1L mouse monoclonal antibody,clone OTI4B4, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GTF2A1L mouse monoclonal antibody,clone OTI1D3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ALF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV |
Rabbit Polyclonal Anti-ALF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV |
Rabbit Polyclonal Anti-GTF2A1L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GTF2A1L Antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: GSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEEEADSISNEDSATNS |
Rabbit Polyclonal Anti-GTF2A1L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GTF2A1L Antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD |
Rabbit Polyclonal Anti-GTF2A1L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2A1L antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: RVTDDDIGEIIQVDGSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEE |
GTF2A1L mouse monoclonal antibody,clone OTI4B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |