Rabbit polyclonal anti-TF2H2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H2. |
Rabbit polyclonal anti-TF2H2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H2. |
Rabbit Polyclonal Anti-Gtf2h2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Gtf2h2 antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Gtf2h2. Synthetic peptide located within the following region: SLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKP |
Rabbit Polyclonal Anti-TF2H2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TF2H2 Antibody: A synthesized peptide derived from human TF2H2 |