HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,007.00
2 Weeks
Lenti ORF particles, HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
USD 1,007.00
7 Weeks
Lenti ORF particles, HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
USD 1,007.00
7 Weeks
Lenti ORF particles, HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
USD 1,007.00
7 Weeks
Lenti ORF particles, HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HLA (tGFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HLA (tGFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HLA (tGFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit polyclonal Anti-HLA-F Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
Lenti-ORF clone of HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit polyclonal Anti-HLA-F Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN |
Transient overexpression lysate of major histocompatibility complex, class I, F (HLA-F), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |