Research Areas

cDNA Clones (22)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone
RC212120

USD 457.00

In Stock

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone Lentiviral Particle
RC212120L1V

USD 1,007.00

2 Weeks

Lenti ORF particles, HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone Lentiviral Particle
RC212120L2V

USD 1,007.00

7 Weeks

Lenti ORF particles, HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone Lentiviral Particle
RC212120L3V

USD 1,007.00

7 Weeks

Lenti ORF particles, HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone Lentiviral Particle
RC212120L4V

USD 1,007.00

7 Weeks

Lenti ORF particles, HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

HLAF (HLA-F) (NM_018950) Human Tagged ORF Clone
RC217084

USD 732.00

In Stock

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HLAF (HLA-F) (NM_001098478) Human Tagged ORF Clone
RC213005

USD 480.00

In Stock

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HLAF (HLA-F) (NM_018950) Human Tagged ORF Clone
RG217084

USD 932.00

In Stock

HLA (tGFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone
RG212120

USD 657.00

3 Weeks

HLA (tGFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HLAF (HLA-F) (NM_001098478) Human Tagged ORF Clone
RG213005

USD 680.00

3 Weeks

HLA (tGFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HLAF (HLA-F) (NM_001098479) Human Tagged Lenti ORF Clone
RC212120L1

USD 757.00

In Stock

Lenti-ORF clone of HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
HLAF (HLA-F) Rabbit Polyclonal Antibody
TA331071

USD 539.00

5 Days

Rabbit polyclonal Anti-HLA-F Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT
HLAF (HLA-F) (NM_018950) Human Tagged Lenti ORF Clone
RC217084L3

USD 1,032.00

5 Days

Lenti-ORF clone of HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) Rabbit Polyclonal Antibody
TA331070

USD 539.00

5 Days

Rabbit polyclonal Anti-HLA-F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
HLAF (HLA-F) (NM_001098479) Human Over-expression Lysate
LY420587

USD 665.00

In Stock

Transient overexpression lysate of major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB