Research Areas

View as table Download

Rabbit Polyclonal Anti-LEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the N terminal of human LEF1. Synthetic peptide located within the following region: VARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMN

Transient overexpression lysate of lymphoid enhancer-binding factor 1 (LEF1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

LEF1 (untagged)-Human lymphoid enhancer-binding factor 1 (LEF1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

LEF1 (untagged)-Human lymphoid enhancer-binding factor 1 (LEF1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

LEF1 (untagged)-Human lymphoid enhancer-binding factor 1 (LEF1) transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

USD 1,174.00

4 Weeks

Transient overexpression of LEF1, transcript variant 1, in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names LEF-1; TCF1ALPHA; TCF7L3; TCF10
Accession Number NM_016269, NP_057353

USD 1,174.00

4 Weeks

Transient overexpression of LEF1, transcript variant 2, in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names LEF-1; TCF1ALPHA; TCF7L3; TCF10
Accession Number NM_001130713, NP_001124185

USD 1,174.00

4 Weeks

Transient overexpression of LEF1, transcript variant 3, in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names LEF-1; TCF1ALPHA; TCF7L3; TCF10
Accession Number NM_001130714, NP_001124186