Germany
Japan
United Kingdom
China
Rabbit anti-HADH Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HADH |
Research Areas
View as table Download
Rabbit anti-ACSL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACSL5 |
Rabbit anti-ACADM Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACADM |
Rabbit Polyclonal Anti-Adh7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Adh7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Adh7. Synthetic peptide located within the following region: LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTL |
ACAA2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Porcine, Rat, African clawed frog |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the N terminal of human ACAA2 |
Goat Polyclonal Antibody against HADH / HADHSC
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YERGDASKEDID, from the internal region of the protein sequence according to NP_005318.2. |
Goat Polyclonal Antibody against ADH1A, B, C
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence STAGKVMKCKA, from the N Terminus of the protein sequence according to NP_000658.1; NP_000659.2; NP_000660.1. |
Goat Anti-ADH5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KKIKVDEFVTHN, from the internal region of the protein sequence according to NP_000662.3 . |
Rabbit anti-ACAT2 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat, Sheep, Pig, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT 2 |
Rabbit polyclonal anti-ACSL6 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACSL6. |
Rabbit Polyclonal Anti-ACOX3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT |
ADH5 mouse monoclonal antibody,clone OTI4H10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ECI1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ECI1 |
Mouse Monoclonal ALDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey, Hamster |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Mouse
Pathways
- Fatty acid metabolism
Filter by
Category
Target Symbol
- ACAT2 (56)
- HADHSC (50)
- ACAA2 (43)
- ADH5 (27)
- ACADM (17)
- ADH7 (16)
- CPT1B (11)
- ALDH7A1 (10)
- ACADS (7)
- ACSL5 (6)
- HADHA (6)
- ACAA1 (5)
- ALDH2 (5)
- PECI (5)
- ALDH9A1 (4)
- CPT1A (3)
- CPT2 (2)
- ACAT1 (1)
- ACOX1 (1)
- ACOX3 (1)
- ACSL1 (1)
- ACSL6 (1)
- ADH1B (1)
- ADH4 (1)
- ALCOHOL DEHYDROGENASE (1)
- DCI (1)
- ECHS1 (1)
- EHHADH (1)
- FACL4 (1)