Research Areas

cDNA Clones (8)
Antibodies (2)
Jump to Filters
View as table Download
ALG10 (NM_032834) Human Tagged ORF Clone
RC223859

USD 457.00

In Stock

ALG10 (Myc-DDK-tagged)-Human asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) (ALG10)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ALG10 (NM_032834) Human Tagged ORF Clone
RG223859

USD 657.00

In Stock

ALG10 (tGFP-tagged) - Human asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) (ALG10)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ALG10 (N-term) Rabbit Polyclonal Antibody
AP50145PU-N

USD 580.00

2 Weeks

ALG10 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 17~43 amino acids from the N-terminal region of human ALG10
ALG10 (NM_032834) Human Tagged Lenti ORF Clone
RC223859L3

USD 757.00

3 Weeks

Lenti ORF clone of Human asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) (ALG10), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ALG10 (NM_032834) Human Tagged Lenti ORF Clone
RC223859L4

USD 757.00

3 Weeks

Lenti ORF clone of Human asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) (ALG10), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ALG10 (NM_032834) Human Tagged ORF Clone Lentiviral Particle
RC223859L3V

USD 1,007.00

5 Weeks

Lenti ORF particles, ALG10 (Myc-DDK tagged) - Human asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) (ALG10), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ALG10 (NM_032834) Human Tagged ORF Clone Lentiviral Particle
RC223859L4V

USD 1,007.00

5 Weeks

Lenti ORF particles, ALG10 (mGFP-tagged) - Human asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) (ALG10), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ALG10 Rabbit Polyclonal Antibody
TA331308

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALG10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALG10 antibody is: synthetic peptide directed towards the middle region of Human ALG10. Synthetic peptide located within the following region: AVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSM
ALG10 (BC070347) Human Untagged Clone
SC122410

USD 457.00

In Stock

ALG10 (untagged)-Human asparagine-linked glycosylation 10 homolog (yeast, alpha-1,2-glucosyltransferase) (cDNA clone MGC:88353 IMAGE:3839674), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ALG10 (NM_032834) Human Untagged Clone
SC317781

USD 503.00

3 Weeks

ALG10 (untagged)-Human asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) (ALG10)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin