Research Areas

View as table Download

Anti-HMGA1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1

Rabbit polyclonal HMGA1 Antibody (C-term)

Applications FC, IF, WB
Reactivities Human (Predicted: Mouse, Rat, Hamster)
Conjugation Unconjugated
Immunogen This HMGA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 64-93 amino acids from the C-terminal region of human HMGA1.

Goat Anti-HMGA1 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-LASKQEKDGTEK, from the internal region of the protein sequence according to NP_665906.1; NP_665908.1; NP_002122.1; NP_665909.1; NP_665912.1; NP_665910.1.

Anti-HMGA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1

Goat Anti-HMGA1 (aa9-21) Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence C-SQPLASKQEKDGT, from the internal region (near N Terminus) of the protein sequence according to NP_665906.1; NP_002122.1.

Rabbit Polyclonal Anti-HMGA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HMGA1 Antibody: synthetic peptide directed towards the N terminal of human HMGA1. Synthetic peptide located within the following region: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRP

Rabbit Polyclonal Anti-Hmga1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Hmga1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hmga1. Synthetic peptide located within the following region: MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE