Research Areas

Jump to Filters
View as table Download
GATA3 Rabbit Polyclonal Antibody
TA330598

USD 485.00

5 Days

Rabbit Polyclonal Anti-GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS
SOCS1 Rabbit Polyclonal Antibody
TA346364

USD 485.00

5 Days

Rabbit Polyclonal Anti-SOCS1 Antibody

Applications IHC, WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA
PIAS2 Rabbit Polyclonal Antibody
TA339096

USD 485.00

5 Days

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 antibody: synthetic peptide directed towards the C terminal of human PIAS2. Synthetic peptide located within the following region: FLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDI
EGFR Rabbit Polyclonal Antibody
TA312537

USD 380.00

4 Weeks

Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S).
Modifications Phospho-specific
Cyclin D1 (CCND1) Rabbit Polyclonal Antibody
TA321926

USD 380.00

In Stock

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1
HMGA1 Rabbit Polyclonal Antibody
TA322034

USD 380.00

In Stock

Anti-HMGA1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1
SP1 Rabbit Polyclonal Antibody
TA322074

USD 380.00

In Stock

Anti-SP1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 609-622 amino acids of human Sp1 transcription factor
STAT5B Rabbit Polyclonal Antibody
TA322406

USD 380.00

In Stock

Anti-STAT5B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 46-351 amino acids of Human Signal transducer and activator of transcription 5B
SMAD5 Rabbit Polyclonal Antibody
TA323513

USD 380.00

In Stock

Anti-SMAD5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5
GATA3 Rabbit Polyclonal Antibody
TA330597

USD 539.00

5 Days

Rabbit Polyclonal Anti-GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS
PIAS2 Rabbit Polyclonal Antibody
TA350895

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIAS2
STAT6 Rabbit Polyclonal Antibody
TA312080

USD 380.00

In Stock

Rabbit polyclonal STAT6 (Ab-641) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human STAT6 around the phosphorylation site of Tyrosine 641.
EGFR Rabbit Polyclonal Antibody
TA324780

USD 580.00

5 Days

Rabbit polyclonal Phospho-EGFR(Y1172) Antibody

Applications Dot, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EGFR Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y1172 of human EGFR.
Modifications Phospho-specific
STAT5B Rabbit Polyclonal Antibody
TA322407

USD 380.00

In Stock

Anti-STAT5B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 46-351 amino acids of Human Signal transducer and activator of transcription 5B
SMAD5 Rabbit Polyclonal Antibody
TA323512

USD 380.00

In Stock

Anti-SMAD5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5