Germany
Japan
United Kingdom
China
RXRA (Myc-DDK-tagged)-Human retinoid X receptor, alpha (RXRA)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
RXRA (untagged)-Human retinoid X receptor, alpha (RXRA)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 1,007.00
2 Weeks
Lenti ORF particles, RXRA (Myc-DDK tagged) - Human retinoid X receptor, alpha (RXRA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
USD 1,007.00
5 Weeks
Lenti ORF particles, RXRA (mGFP-tagged) - Human retinoid X receptor, alpha (RXRA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
USD 1,007.00
2 Weeks
Lenti ORF particles, RXRA (Myc-DDK tagged) - Human retinoid X receptor, alpha (RXRA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,007.00
2 Weeks
Lenti ORF particles, RXRA (mGFP-tagged) - Human retinoid X receptor, alpha (RXRA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Recombinant protein of human retinoid X receptor, alpha (RXRA), 20 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
RXRA (tGFP-tagged) - Human retinoid X receptor, alpha (RXRA)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
RXRA (tGFP-tagged) - Human retinoid X receptor, alpha (RXRA), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RXRA (tGFP-tagged) - Human retinoid X receptor, alpha (RXRA), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 9,200.00
6 Weeks
Recombinant protein of human retinoid X receptor, alpha (RXRA), 1 mg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 2,950.00
6 Weeks
Recombinant protein of human retinoid X receptor, alpha (RXRA), 100 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
RXRA (myc-DDK-tagged) - Human retinoid X receptor, alpha (RXRA), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RXRA (myc-DDK-tagged) - Human retinoid X receptor, alpha (RXRA), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Active filters
Target Symbol
- RETINOID X RECEPTOR ALPHA
Families
- Nuclear Hormone Receptor