USD 509.00
2 Weeks
RORB mouse monoclonal antibody, clone OTI4B7 (formerly 4B7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
RORB mouse monoclonal antibody, clone OTI4B7 (formerly 4B7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
RORB mouse monoclonal antibody, clone OTI4B7 (formerly 4B7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
RORB mouse monoclonal antibody, clone OTI1C11 (formerly 1C11), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
RORB mouse monoclonal antibody, clone OTI1C11 (formerly 1C11), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-RORB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RORB |
Lenti ORF clone of Human RAR-related orphan receptor B (RORB), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
RORB (untagged)-Human RAR-related orphan receptor B (RORB)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-RORB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RORB antibody: synthetic peptide directed towards the C terminal of human RORB. Synthetic peptide located within the following region: KNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYK |
RORB / ROR Beta Rabbit Polyclonal (Hinge Domain) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Chicken, Dog, Gorilla, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Gibbon, Hamster, Horse (Predicted: Xenopus) |
Conjugation | Unconjugated |
Immunogen | RORB / ROR Beta antibody was raised against synthetic 18 amino acid peptide from hinge domain of human ROR Beta. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Platypus, Lizard (100%); Elephant, Xenopus (94%); Zebrafish (83%). |
Lenti ORF clone of Human RAR-related orphan receptor B (RORB), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human RAR-related orphan receptor B (RORB), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human RAR-related orphan receptor B (RORB), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RORB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
RORB mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RORB mouse monoclonal antibody, clone OTI3D7 (formerly 3D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |