Research Areas

View as table Download

Rabbit Polyclonal Anti-RORB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RORB

RORB (untagged)-Human RAR-related orphan receptor B (RORB)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-RORB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORB antibody: synthetic peptide directed towards the C terminal of human RORB. Synthetic peptide located within the following region: KNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYK

RORB / ROR Beta Rabbit Polyclonal (Hinge Domain) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Dog, Gorilla, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Gibbon, Hamster, Horse (Predicted: Xenopus)
Conjugation Unconjugated
Immunogen RORB / ROR Beta antibody was raised against synthetic 18 amino acid peptide from hinge domain of human ROR Beta. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Platypus, Lizard (100%); Elephant, Xenopus (94%); Zebrafish (83%).

Lenti ORF clone of Human RAR-related orphan receptor B (RORB), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

RORB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

RORB mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI3D7 (formerly 3D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated