Research Areas

View as table Download

CACNA1I (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNA1I (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNA1I (tGFP-tagged) - Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNA1I (tGFP-tagged) - Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-CACNA1I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA1I antibody: synthetic peptide directed towards the middle region of human CACNA1I. Synthetic peptide located within the following region: LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS

Lenti ORF particles, CACNA1I (Myc-DDK tagged) - Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

CACNA1I (untagged)-Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

CACNA1I (untagged)-Human calcium channel, voltage-dependent, T type, alpha 1I subunit (CACNA1I), transcript variant 2

Vector pCMV6 series
Tag Tag Free