WNT3A (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 3A (WNT3A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT3A (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 3A (WNT3A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT3A (mGFP-tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT3A (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF particles, WNT3A (mGFP-tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF particles, WNT3A (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
WNT3A (tGFP-tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
WNT3A (untagged)-Human wingless-type MMTV integration site family, member 3A (WNT3A)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-WNT3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human WNT3A |
WNT3A mouse monoclonal antibody, clone 3A6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
WNT3A mouse monoclonal antibody, clone 3A6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
WNT3A (19-352) human recombinant protein, 0.1 mg
Expression Host | E. coli |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 3A (WNT3A), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 3A (WNT3A), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |