Research Areas

View as table Download

WNT3A (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 3A (WNT3A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, WNT3A (mGFP-tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT3A (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, WNT3A (mGFP-tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, WNT3A (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

WNT3A (tGFP-tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

WNT3A Rabbit monoclonal antibody,clone OTIR4G6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

WNT3A (untagged)-Human wingless-type MMTV integration site family, member 3A (WNT3A)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-WNT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT3A

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated

WNT3A (19-352) human recombinant protein, 0.1 mg

Expression Host E. coli

Lenti ORF clone of Human wingless-type MMTV integration site family, member 3A (WNT3A), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 3A (WNT3A), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA