Research Areas

View as table Download

PAX7 mouse monoclonal antibody,clone OTI4A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAX7 mouse monoclonal antibody,clone OTI4G5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAX7 mouse monoclonal antibody,clone OTI4A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAX7 mouse monoclonal antibody,clone OTI4G5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAX7 mouse monoclonal antibody,clone OTI4A7, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PAX7 mouse monoclonal antibody,clone OTI4A7, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PAX7 mouse monoclonal antibody,clone OTI4G5, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PAX7 mouse monoclonal antibody,clone OTI4G5, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Rabbit Polyclonal Anti-PAX7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the middle region of human PAX7. Synthetic peptide located within the following region: KPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPI

PAX7 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 417-445 amino acids from the C-terminal region of human PAX7

PAX7 mouse monoclonal antibody,clone OTI4A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAX7 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 180-210 amino acids from the Central region of human PAX

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: CDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGIL

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PAX7 antibody is: synthetic peptide directed towards the C-terminal region of PAX7. Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT