Research Areas

View as table Download

WNT1 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 1 (WNT1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, WNT1 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, WNT1 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, WNT1 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT1 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

WNT1 (untagged)-Human wingless-type MMTV integration site family, member 1 (WNT1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

WNT1 (tGFP-tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 1 (WNT1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-WNT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT1

Lenti ORF clone of Human wingless-type MMTV integration site family, member 1 (WNT1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

WNT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-WNT1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV

Lenti ORF clone of Human wingless-type MMTV integration site family, member 1 (WNT1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal anti-WNT1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human WNT1.

Purified recombinant protein of Human wingless-type MMTV integration site family, member 1 (WNT1), full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug

Tag N-GST and C-HIS
Expression Host E. coli