Research Areas

View as table Download

Rabbit Polyclonal Anti-WNT5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT

WNT5A mouse monoclonal antibody, clone 6F2, Ascites

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

WNT5A Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human WNT5A (NP_003383.2).
Modifications Unmodified

Rabbit Polyclonal Wnt-5a Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2.

WNT5A mouse monoclonal antibody, clone 3D10, Ascites

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated

WNT5A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT5A

Wnt5a Rabbit polyclonal Antibody

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Wnt5a

WNT5A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-380 of human WNT5A (NP_003383.2).
Modifications Unmodified