Germany
Japan
United Kingdom
China
RXRA (Myc-DDK-tagged)-Human retinoid X receptor, alpha (RXRA)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
RXRA (untagged)-Human retinoid X receptor, alpha (RXRA)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human retinoid X receptor, alpha (RXRA), 20 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PPARG (tGFP-tagged) - Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1, 20 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PPARG (untagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
PPARG (untagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PPARG (untagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PPARG (untagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RXR-alpha / RXRA (111-228) human protein, 0.1 mg
| Expression Host | E. coli |
Active filters
Families
- Nuclear Hormone Receptor
Pathways
- Thyroid cancer
Citations
- Yes