Research Areas

View as table Download

Rabbit Polyclonal Anti-KLK6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KLK6

Rabbit polyclonal Kallikrein 6 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Kallikrein 6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Kallikrein 6.

Rabbit polyclonal Kallikrein 6 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Kallikrein 6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 126-156 amino acids from the Central region of human Kallikrein 6.

Rabbit Polyclonal Anti-KLK6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLK6 antibody: synthetic peptide directed towards the N terminal of human KLK6. Synthetic peptide located within the following region: KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ

Rabbit Polyclonal Kallikrein 6 Antibody

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length human KLK6 protein [Swiss-Prot# Q92876] expressed in E. coli.