Research Areas

View as table Download

Rabbit Polyclonal Anti-BACE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

BACE1 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 38-70 amino acids from the N-terminal region of Human BACE1.

Rabbit Polyclonal BACE Antibody

Applications ELISA, ICC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen BACE antibody was raised against a peptide corresponding to 17 amino acids at the carboxy terminus of human BACE.

Anti-BACE1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human beta-site APP-cleaving enzyme 1
TA324168 is a possible alternative to TA349256.

BACE1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-322 of human BACE1 (NP_036236.1).
Modifications Unmodified

BACE1 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide corresponding to amino acid residues surrounding S498 of Human BACE.

BACE1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 480-520 of Human BACE.

Rabbit Polyclonal Anti-BACE1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen BACE1 / BACE antibody was raised against synthetic 15 amino acid peptide from internal region of human BACE1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Guinea pig (100%); Platypus (87%); Xenopus, Pufferfish, Zebrafish, Stickleback (80%).