Research Areas

View as table Download

Rabbit polyclonal Anti-ST6GALNAC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST6GALNAC4 antibody: synthetic peptide directed towards the middle region of human ST6GALNAC4. Synthetic peptide located within the following region: QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMIL

ST6GALNAC4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human ST6GALNAC4 (NP_778204.1).
Modifications Unmodified