Germany
Japan
United Kingdom
China
TCF7L2 (Myc-DDK-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
TCF7L2 (Myc-DDK-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
TCF7L2 (Myc-DDK-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 12
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
TCF7L2 (Myc-DDK-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 7
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
TCF7L2 (Myc-DDK-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
TCF7L2 (Myc-DDK-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
TCF7L2 (Myc-DDK-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 13
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Tcf7l2 (Myc-DDK-tagged) - Mouse transcription factor 7-like 2, T-cell specific, HMG-box (Tcf7l2), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (tGFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tcf7l2 (Myc-DDK-tagged) - Mouse transcription factor 7-like 2, T-cell specific, HMG-box (Tcf7l2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (Myc-DDK-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tcf7l2 (tGFP-tagged) - Mouse transcription factor 7-like 2 T-cell specific HMG-box (Tcf7l2) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (Myc-DDK-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 10
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (tGFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Active filters
Target Symbol
- TCF7L2
Availabilities
- In Stock