Research Areas

Antibodies (2)
Proteins (1)
Jump to Filters
View as table Download
NDUFA3 Rabbit Polyclonal Antibody
TA350213

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-NDUFA3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFA3
NDUFA3 Rabbit Polyclonal Antibody
TA343224

USD 539.00

5 Days

Rabbit Polyclonal Anti-NDUFA3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ndufa3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ndufa3. Synthetic peptide located within the following region: ISPYTKYASMINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLKNL
NDUFA3 (NM_004542) Human Over-expression Lysate
LY417934

USD 436.00

5 Days

Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa (NDUFA3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB