BMP4 mouse monoclonal antibody,clone UMAB42
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP4 mouse monoclonal antibody,clone UMAB42
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP4 mouse monoclonal antibody,clone UMAB42
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP4 mouse monoclonal antibody,clone UMAB42
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-WNT3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human WNT3A |
Rabbit Polyclonal Anti-BMP6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BMP6 |
WNT3A mouse monoclonal antibody, clone 3A6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
WNT3A mouse monoclonal antibody, clone 3A6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-BMP4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4 |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-WNT8A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT8A |
Rabbit Polyclonal Anti-BMP7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ |
Rabbit anti-BMP7 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMP7 |
WNT8A Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gorilla, Human, Monkey, Gibbon, Horse (Predicted: Bovine, Dog) |
Conjugation | Unconjugated |
Immunogen | WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Panda, Horse (100%); Bovine, Dog (93%); Rabbit (86%). |