Anti-FABP3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 95-108 amino acids of Human Fatty acid-binding protein 3 |
Anti-FABP3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 95-108 amino acids of Human Fatty acid-binding protein 3 |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the N terminal of human FABP3. Synthetic peptide located within the following region: NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG |
FABP3 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human FABP3 |
FABP3 goat polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_004093.1. |
Mouse monoclonal FAPB3 Antibody(Ascites)
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal H-FABP Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal H-FABP Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 67D3, Biotin
Applications | ELISA, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
FABP3 mouse monoclonal antibody, clone 67D3, Purified
Applications | ELISA, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 66E2, Biotin
Applications | ELISA, IP, WB |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Biotin |
FABP3 mouse monoclonal antibody, clone 66E2, Purified
Applications | ELISA, IP, WB |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 22
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 30
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |