FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4), 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
FABP4 (tGFP-tagged) - Human fatty acid binding protein 4, adipocyte (FABP4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit monoclonal anti-FABP4 antibody for SISCAPA, clone OTIR5E9
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-FABP4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Lenti-ORF clone of FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of FABP4 (mGFP-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Mouse monoclonal anti-FABP4 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4)
Tag | N-His |
Expression Host | E. coli |
Rabbit anti-FABP4 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FABP4 |
FABP4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-FABP4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM |
Lenti-ORF clone of FABP4 (mGFP-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF particles, FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |