Germany
Japan
United Kingdom
China
FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Traumatic Brain Injury Research Tools
View as table Download
Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4), 20 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
FABP4 (tGFP-tagged) - Human fatty acid binding protein 4, adipocyte (FABP4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit monoclonal anti-FABP4 antibody for SISCAPA, clone OTIR5E9
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Lenti-ORF clone of FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of FABP4 (mGFP-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Mouse monoclonal anti-FABP4 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4)
| Tag | N-His |
| Expression Host | E. coli |
FABP4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-FABP4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM |
Lenti-ORF clone of FABP4 (mGFP-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF particles, FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Active filters
Target Symbol
- FABP4
Pathways
- PPAR signaling pathway