Traumatic Brain Injury Research Tools

View as table Download

Rabbit monoclonal anti-FABP4 antibody for SISCAPA, clone OTIR5E9

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FABP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Mouse monoclonal anti-FABP4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

FABP4 mouse monoclonal antibody, clone 3F4, Purified

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit anti-FABP4 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FABP4

FABP4 mouse monoclonal antibody, clone 9B8D, Ascites

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

FABP4 mouse monoclonal antibody, clone 3F4, Purified

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-FABP4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM

FABP4 mouse monoclonal antibody, clone 5H11A4E11, Ascites

Applications WB
Reactivities Human
Conjugation Unconjugated

FABP4 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide corresponding to amino acid residues surrounding Y20 of human FABP4.

FABP4 goat polyclonal antibody, Aff - Purified

Applications WB
Reactivities Canine, Human
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_001433.1.

Rabbit Polyclonal Anti-FABP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM

FABP4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human FABP4

FABP4 rabbit polyclonal antibody, Azide Free

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunization antigen (14.7 kDa) is a protein containing 131 AA of recombinant Human FABP4 and one extra AA, N-terminal Methionin (highlighted).